BDBM194645 US9206139, 4

SMILES CC(C)[C@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1

InChI Key InChIKey=VXXYNKXMRXANKX-KXBFYZLASA-N

Data  20 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 3 hits for monomerid = 194645   

TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194645(US9206139, 4)
Affinity DataIC50:  8nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194645(US9206139, 4)
Affinity DataIC50:  150nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194645(US9206139, 4)
Affinity DataIC50:  8nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent